
Western blot analysis of nmt55 p54nrb using anti-nmt55 p54nrb antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human HELA whole cell lysate, Lane 2: human Placent tissue lysate, Lane 3: human MCF-7 whole cell lysate, Lane 4: human A549 whole cell lysate, Lane 5: human SW620 whole cell lysate, Lane 6: human PANC-1 whole cell lysate, Lane 7: human U20S whole cell lysate, Lane 8: human K562 whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-nmt55 p54nrb antigen affinity purified monoclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.
NONO / P54NRB Antibody
| Antibody: | Mouse Monoclonal |
| Applications: | Flow Cytometry, Immunocytochemistry, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- P54NRB antibody LS-C756669 is an unconjugated mouse monoclonal antibody to human P54NRB (NONO). Validated for Flow, ICC and WB.
- Application
- FC, ICC, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Monoclonal Antibodies
- Alternative Names
- 55 kDa nuclear protein | NRB54 | NMT55 | NonO protein | p54 | p54(nrb) | p54NRB | NONO
- UniProt Number
- Q15233
- NCBI GenBank
- NM_007363 | NP_031389.3
- SwissProt
- Q15233
| Application | Dilution |
|---|---|
| FC | 1 - 3 µg/10E6 cells |
| IF/ICC | 0.5 - 1 µg/ml |
| WB | 0.1 - 0.5 µg/ml |
Target
- Target
- Human NONO / P54NRB
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- NONO
Antibody
- Host Species
- Mouse
- Clonality
- Monoclonal
- Isotype
- IgG1
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human nmt55 p54nrb (1-35 aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
- Recommended Storage Buffer
- NaCl
