Western blot analysis of NIRF expression in rat testis extract (lane 1) and K562 whole cell lysates (lane 2). NIRF at 90 kD was detected using rabbit anti- NIRF Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
NIRF / UHRF2 Antibody (aa15-54)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408118-100
Catalog Number: LS-C408118
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- UHRF2 antibody LS-C408118 is an unconjugated rabbit polyclonal antibody to UHRF2 (NIRF) (aa15-54) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, GP, Hu, Ms, Por, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Np95-like RING finger protein | NIRF | Nuclear protein 97 | URF2 | RING finger protein 107 | RNF107 | UHRF2 | RP11-472F14.2
- UniProt Number
- Q96PU4
- NCBI GenBank
- NM_152896 | NP_690856.1
- SwissProt
- Q96PU4
Target
- Target
- Human NIRF / UHRF2
- Antigen Species
- Human
- Gene Name
- UHRF2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human NIRF (15-54 aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl