Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot - Anti-NFIB/NF1B2 Picoband antibody
NFIB Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662541-100
Catalog Number: LS-C662541
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NFIB antibody LS-C662541 is an unconjugated rabbit polyclonal antibody to human NFIB. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CTF | HMGIC/NFIB | NF1-B | NFI-B | NFIB | NFIB3 | NFIB2 | Nuclear factor 1 B-type | Nuclear factor 1/B | Nuclear factor I-b2 | Nuclear factor I/B | TGGCA-binding protein | NF-I/B | NFI-RED
- UniProt Number
- O00712
- NCBI GenBank
- NM_005596 | NP_005587.2
- SwissProt
- O00712
Target
- Target
- Human NFIB
- Antigen Species
- Human
- Gene Name
- NFIB
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human NFIB/NF1B2 (ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
