Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Neuroserpin antibody Western blot. All lanes: Anti Neuroserpin at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Brain Tissue Lysate at 50 ug. Lane 3: PANC Whole Cell Lysate at 40 ug. Predicted band size: 46 kD. Observed band size: 46 kD.
Neuroserpin Antibody (aa272-310)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407956-100
Catalog Number: LS-C407956
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Neuroserpin antibody LS-C407956 is an unconjugated rabbit polyclonal antibody to Neuroserpin (aa272-310) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Neuroserpin | Peptidase inhibitor 12 | PI12 | Serpin I1 | SERPINI1 | PI-12 | Protease inhibitor 12
- UniProt Number
- Q99574
- NCBI GenBank
- NM_005025 | NP_005016.1
- SwissProt
- Q99574
Target
- Target
- Human Neuroserpin
- Antigen Species
- Human
- Epitope
- Predominantly expressed in the brain.
- Gene Name
- SERPINI1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Neuroserpin (272-310 aa KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKA L), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino aci
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
