Western blot analysis of extracts of mouse testis tissue, using NEUROG3 antibody.
NEUROG3 / NGN3 / Neurogenin 3 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C332242-20
Catalog Number: LS-C332242
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Neurogenin 3 antibody LS-C332242 is an unconjugated rabbit polyclonal antibody to Neurogenin 3 (NEUROG3 / NGN3) from human. It is reactive with human and mouse. Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BHLHa7 | Atoh5 | Math4B | Neurogenin-3 | NGN-3 | Ngn3 | Neurogenin 3 | Protein atonal homolog 5 | NEUROG3
- Recommended Dilution: WB
- 1:500 - 1:1000
- UniProt Number
- Q9Y4Z2
- NCBI GenBank
- NM_020999 | NP_066279.2
- SwissProt
- Q9Y4Z2
Target
- Target
- Human NEUROG3 / NGN3 / Neurogenin 3
- Antigen Species
- Human
- Epitope
- Human NEUROG3 / NGN3 / Neurogenin 3.
- Gene Name
- NEUROG3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human NEUROG3 (NP_066279.2). MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRKLRARRGGRSRPKSELALSKQRRS
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS