Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
NECAP2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C749550-20
Catalog Number: LS-C749550
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NECAP2 antibody LS-C749550 is an unconjugated rabbit polyclonal antibody to human NECAP2. Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- NECAP-2 | NECAP endocytosis associated 2 | NECAP2
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q9NVZ3
- NCBI GenBank
- NM_018090 | NP_060560.1
- SwissProt
- Q9NVZ3
Target
- Target
- Human NECAP2
- Antigen Species
- Human
- Gene Name
- NECAP2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 194-263 of human NECAP2 (NP_060560.1). GKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
