
Western blot testing of human 293T cell lysate with NARG1 antibody at 0.5ug/ml. Predicted molecular weight ~101 kDa.
NARG1 / NAA15 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782010-100
Catalog Number: LS-C782010
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NAA15 antibody LS-C782010 is an unconjugated rabbit polyclonal antibody to NAA15 (NARG1) from human. It is reactive with human and mouse. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Ga19 | Gastric cancer antigen Ga19 | Protein tubedown-1 | Tubedown-1 | NAA15 | NARG1 | TBDN100 | N-terminal acetyltransferase | NATH | NMDA receptor regulated 1
- UniProt Number
- Q9BXJ9
- SwissProt
- Q9BXJ9
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 1 - 2 µg/ml |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human NARG1 / NAA15
- Antigen Species
- Human
- Gene Name
- NAA15
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 244-287 (ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY) from the human protein were used as the immunogen for the NARG1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
