Western blot - Anti-Nanog Picoband Antibody

NANOG Antibody

Name: NANOG Antibody
Brand: LSBio
SKU: LS-C661930-100
Price: 480 USD
Availability: InStock

$480.00each

Catalog Number: LS-C661930-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: NANOG antibody LS-C661930 is an unconjugated rabbit polyclonal antibody to human NANOG. Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: NANOG | Nanog homeobox | NANOGP8 | HNanog | Homeobox protein NANOG
UniProt Number: Q9H9S0
NCBI GenBank: AB062943 | NP_079141.2
SwissProt: Q9H9S0

Target: Human NANOG
Antigen Species: Human
Epitope: Expressed in testicular carcinoma and derived germ cell tumors (at protein level). Expressed in fetal gonads, ovary and testis. Also expressed in ovary teratocarcinoma cell line and testicular embryonic carcinoma. Not expressed in many somatic organs and oocytes. .
Gene Name: NANOG

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Nanog (115-155 aa QRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQK), different from the related mouse sequence by three amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl