Western blot analysis of extracts of U-937 cells, using NLRP3 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
NALP3 / NLRP3 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C747781-20
Catalog Number: LS-C747781
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NLRP3 antibody LS-C747781 is an unconjugated rabbit polyclonal antibody to human NLRP3 (NALP3). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AGTAVPRL | AII | C1orf7 | Caterpiller protein 1.1 | Cryopyrin | FCAS | FCU | NLRP3 | PYPAF1 | NALP3 | CIAS1 | CLR1.1 | MWS
- Recommended Dilution: WB
- 1:1000 - 1:3000
- UniProt Number
- Q96P20
- NCBI GenBank
- NM_004895 | NP_004886.3
- SwissProt
- Q96P20
Target
- Target
- Human NALP3 / NLRP3
- Antigen Species
- Human
- Gene Name
- NLRP3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 900 to the C-Terminus of human NLRP3 (NP_001120934.1). CCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS