
Western blot analysis of extracts of various cells.
NAF-1 / CISD2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C335554-20
Catalog Number: LS-C335554
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CISD2 antibody LS-C335554 is an unconjugated rabbit polyclonal antibody to CISD2 (NAF-1) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CDGSH2 | ERIS | Miner1 | MitoNEET related 1 | MitoNEET-related 1 protein | WFS2 | NAF-1 | Wolfram syndrome 2 | CDGSH iron sulfur domain 2 | CISD2 | ZCD2
- UniProt Number
- Q8N5K1
- SwissProt
- Q8N5K1
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:500 - 1:2000 |
Target
- Target
- Human NAF-1 / CISD2
- Antigen Species
- Human
- Epitope
- Human NAF-1 / CISD2
- Gene Name
- CISD2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 61-135 of human CISD2 (NP_001008389.1). PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
