
Western blot analysis of extracts of various cell lines.
MYOT / Myotilin Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C334718-20
Catalog Number: LS-C334718
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Myotilin antibody LS-C334718 is an unconjugated rabbit polyclonal antibody to Myotilin (MYOT) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
- Application
- IF, IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 57 kDa cytoskeletal protein | LGMD1 | MYOT | LGMD1A | TTID | Myotilin
- Recommended Dilution: IF/ICC
- 1:10 - 1:100
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q9UBF9
- NCBI GenBank
- NM_006790 | NP_006781.1
- SwissProt
- Q9UBF9
Target
- Target
- Human MYOT / Myotilin
- Antigen Species
- Human
- Epitope
- Human MYOT / Myotilin
- Gene Name
- MYOT
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 259-314 of human MYOT (NP_001129412.1). RPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPEGEFQRLAAQSGLYESEEL
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
