Immunohistochemistry of paraffin-embedded mouse brain using MYO10 antibody (40x lens).
MYO10 / Myosin-X Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C747574-20
Catalog Number: LS-C747574
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Myosin-X antibody LS-C747574 is an unconjugated rabbit polyclonal antibody to Myosin-X (MYO10) from human. It is reactive with human and mouse. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- MYO10 | Myosin X | Myosin-X | Unconventional myosin-10 | Unconventional myosin-X | Unconventionnal myosin-X | KIAA0799
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q9HD67
- NCBI GenBank
- NM_012334, NP_036466.2
- SwissProt
- Q9HD67
Target
- Target
- Human MYO10 / Myosin-X
- Antigen Species
- Hu
- Gene Name
- MYO10
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Hu
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 845-944 of human MYO10 (NP_036466.2). EAELRAQQEEETRKQQELEALQKSQKEAELTRELEKQKENKQVEEILRLEKEIEDLQRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLES
- Immunogen Type
- Fusion-P
Format
- Conjugate/Label
- Unconj
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS