Western blot analysis of extracts of various cell lines, using MYH2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 180s.

MYH2 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C750264-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: MYH2 antibody LS-C750264 is an unconjugated rabbit polyclonal antibody to MYH2 from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Fast 2a myosin heavy chain | MYH2 | MyHC-IIa | Myosin heavy chain 2a | MyHC-2A | Myosin-2 | MYHSA2 | Myosin heavy chain 2 | MYH2A | MYHas8 | Myosin heavy chain IIa | Type IIA myosin heavy chain
Recommended Dilution: WB: 1:200 - 1:2000
UniProt Number: Q9UKX2
NCBI GenBank: NM_017534 | NP_060004.3
SwissProt: Q9UKX2

Target

Target: Human MYH2
Antigen Species: Human
Gene Name: MYH2

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human MYH2 (NP_001093582.1). SFKNKLYDQHLGKSANFQKPKVVKGKAEAHFALIHYAGVVDYNITGWLEKNKDPLNETVVGLYQKSAMKTLAQLFSGAQTAEGEGAGGGAKKGGKKKGSSF
Immunogen Type: Synthetic Peptide (Linear)