Western blot analysis of extracts of various cell lines, using MYH13 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.

MYH13 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C749614-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: MYH13 antibody LS-C749614 is an unconjugated rabbit polyclonal antibody to MYH13 from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Extraocular myosin heavy chain | Myosin heavy chain 13 | MYH13 | MyHC-eo | Myosin-13
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q9UKX3
NCBI GenBank: NM_003802 | NP_003793.2
SwissProt: Q9UKX3

Target

Target: Human MYH13
Antigen Species: Human
Gene Name: MYH13

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1240-1320 of human MYH13 (NP_003793.2). EALSKSKSNIERTCRTVEDQFSEIKAKDEQQTQLIHDLNMQKARLQTQNGELSHRVEEKESLISQLTKSKQALTQQLEELK
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)