
IHC testing of FFPE human breast cancer tissue with Musashi antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
MSI1 / Musashi 1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781935-100
Catalog Number: LS-C781935
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Musashi 1 antibody LS-C781935 is an unconjugated rabbit polyclonal antibody to Musashi 1 (MSI1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- MSI1 | Musashi homolog 1 (Drosophila) | Musashi RNA-binding protein 1 | Musashi (Drosophila) homolog 1 | Musashi1 | Musashi 1 | Musashi-1
- UniProt Number
- O43347
- NCBI GenBank
- NM_002442 | NP_002433.1
- SwissProt
- O43347
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 1 - 2 µg/ml |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human MSI1 / Musashi 1
- Antigen Species
- Human
- Gene Name
- MSI1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 21-54 (KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD) from the human protein were used as the immunogen for the Musashi antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
