
Western blot testing of rat NRK cell lysate with MMP-9 antibody at 0.5ug/ml. Predicted molecular weight: 92/67-80 kDa (precursor/mature forms).
MMP9 / Gelatinase B Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781778-100
Catalog Number: LS-C781778
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Gelatinase B antibody LS-C781778 is an unconjugated rabbit polyclonal antibody to Gelatinase B (MMP9) from mouse. It is reactive with mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 92kd gelatinase | 92 kDa gelatinase | Matrix metalloproteinase-9 | MMP9 | MMP-9 | CLG4B | Gelatinase B | GELB | Macrophage gelatinase | MANDP2
- UniProt Number
- P14780
- NCBI GenBank
- NM_004994 | NP_004985.2
- SwissProt
- P14780
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 1 - 2 µg/ml |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Mouse MMP9 / Gelatinase B
- Antigen Species
- Mouse
- Gene Name
- MMP9
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids RRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFS were used as the immunogen for the MMP-9 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at 4°C. After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
