Western blot - Anti-MMP-9 Picoband Antibody
MMP9 / Gelatinase B Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662293-100
Catalog Number: LS-C662293
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Gelatinase B antibody LS-C662293 is an unconjugated rabbit polyclonal antibody to rat Gelatinase B (MMP9). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 92kd gelatinase | 92 kDa gelatinase | Matrix metalloproteinase-9 | MMP9 | MMP-9 | CLG4B | Gelatinase B | GELB | Macrophage gelatinase | MANDP2
- UniProt Number
- P14780
- NCBI GenBank
- NM_004994 | NP_004985.2
- SwissProt
- P14780
Target
- Target
- Rat MMP9 / Gelatinase B
- Antigen Species
- Rat
- Gene Name
- MMP9
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of rat MMP-9 (622-658 aa RRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFS), different from the related human sequence by nineteen amino acids, and from the related mouse sequence by nine amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl