MMP9 antibody Western blot. All lanes: Anti MMP9 at 0.5 ug/ml. Lane 1: NRK Whole Cell Lysate at 40 ug. Lane 2: ANA-1 Whole Cell Lysate at 40 ug. Lane 3: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 78 kD. Observed band size: 78 kD.
MMP9 / Gelatinase B Antibody (aa641-672)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407881-100
Catalog Number: LS-C407881
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Gelatinase B antibody LS-C407881 is an unconjugated rabbit polyclonal antibody to Gelatinase B (MMP9) (aa641-672) from mouse. It is reactive with mouse and rat. Validated for ELISA, IHC and WB.
- Application
- ELISA, IHC, IHC-P, WB
- Reactivity
- Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 92kd gelatinase | 92 kDa gelatinase | Matrix metalloproteinase-9 | MMP9 | MMP-9 | CLG4B | Gelatinase B | GELB | Macrophage gelatinase | MANDP2
- Recommended Dilution: ELISA
- 0.1 - 0.5 ug/ml
- UniProt Number
- P14780
- NCBI GenBank
- NM_004994, NP_004985.2
- SwissProt
- P14780
Target
- Target
- Mouse MMP9 / Gelatinase B
- Antigen Species
- Ms
- Gene Name
- MMP9
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of mouse MMP-9 (641-672 aa KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF), different from the related human sequence by thirteen amino acids, and from the related rat sequence by eight amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl