MMP8 antibody Western blot. All lanes: Anti MMP8 at 0.5 ug/ml. Lane 1: K562 Whole Cell Lysate at 40 ug. Lane 2: JURKAT Whole Cell Lysate at 40 ug. Predicted band size: 60 kD. Observed band size: 60 kD.

MMP8 Antibody (aa119-153)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Enzyme-Linked Immunosorbent Assay, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C407938-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: MMP8 antibody LS-C407938 is an unconjugated rabbit polyclonal antibody to human MMP8 (aa119-153). Validated for ELISA, IHC and WB.
Application: ELISA, IHC, IHC-P, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: CLG1 | HNC | Matrix metalloproteinase-8 | MMP8 | MMP-8 | Neutrophil collagenase | PMNL collagenase | PMNL-CL
Recommended Dilution: ELISA: 0.1 - 0.5 ug/ml
UniProt Number: P22894
NCBI GenBank: NM_002424 | NP_002415.1
SwissProt: P22894

Target

Target: Human MMP8
Antigen Species: Human
Epitope: Neutrophils.
Gene Name: MMP8

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human MMP-8 (119-153 aa NYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQ), different from the related mouse sequence by eleven amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl