antibody, PBMMP12, Western blot. All lanes: Anti MMP12 at 0.5 ug/ml. WB: HEPA Whole Cell Lysate at 40 ug. Predicted band size: 55 kD. Observed band size: 55 kD.

MMP12 Antibody (aa432-466)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Enzyme-Linked Immunosorbent Assay, Western Blot
Reactivity:	Mouse
Format:	Lyophilized

$480.00each

Catalog Number: LS-C408144-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: MMP12 antibody LS-C408144 is an unconjugated rabbit polyclonal antibody to mouse MMP12 (aa432-466). Validated for ELISA and WB.
Application: ELISA, WB
Reactivity: Ms
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: HME | Macrophage metalloelastase | Metalloelastase | MMP-12 | MMP12 | ME | Macrophage elastase | Matrix metalloproteinase-12
Recommended Dilution: ELISA: 0.1 - 0.5 ug/ml
UniProt Number: P39900
NCBI GenBank: NM_002426 | NP_002417.2
SwissProt: P39900

Target

Target: Mouse MMP12
Antigen Species: Mouse
Gene Name: MMP12

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of mouse MMP12 (432-466 aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK), different from the related human sequence by thirteen amino acids, and from the related rat sequence by three amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl