Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
MMP10 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490342-100
Catalog Number: LS-C490342
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MMP10 antibody LS-C490342 is an unconjugated rabbit polyclonal antibody to human MMP10. Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Matrix metalloproteinase-10 | MMP10 | SL-2 | STMY2 | Stromelysin 2 | Stromelysin-2 | MMP-10 | Transin 2 | Transin-2 | Stromelysin2 | Matrix metalloprotease 10
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- P09238
- NCBI GenBank
- NM_002425 | NP_002416.1
- SwissProt
- P09238
Target
- Target
- Human MMP10
- Antigen Species
- Human
- Gene Name
- MMP10
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids RFDENSQSMEQGFPRLIADDFPGVEPKVDAVLQAF of human MMP10 were used as the immunogen for the MMP10 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
