
Western blot analysis of extracts of HeLa cells.
MKI67 / Ki67 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C331889-20
Catalog Number: LS-C331889
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Ki67 antibody LS-C331889 is an unconjugated rabbit polyclonal antibody to human Ki67 (MKI67). Validated for IF and WB.
- Application
- IF, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Antigen KI-67 | Ki67 | KIA | MKI67
- Recommended Dilution: IF/ICC
- 1:50 - 1:100
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P46013
- NCBI GenBank
- NM_002417 | NP_002408.3
- SwissProt
- P46013
Target
- Target
- Human MKI67 / Ki67
- Antigen Species
- Human
- Epitope
- Human MKI67 / Ki67
- Gene Name
- MKI67
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1200-1300 of human MKI67 (NP_001139438.1). QKLDLTENLTGSKRRLQTPKEKAQALEDLAGFKELFQTRGHTEESMTNDKTAKVACKSSQPDPDKNPASSKRRLKTSLGKVGVKEELLAVGKLTQTSGETT
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
