IL21 Receptor Antibody
Catalog Number: LS-C487537-100
100 µL / $309.00
Antibody: Rabbit Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay
Reactivity: Human
Format: Liquid
NR3C2 antibody Western blot. All lanes: Anti NR3C2 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Mouse Kidney Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Lane 4: A431 Whole Cell Lysate at 40 ug. Predicted band size: 110 kD. Observed band size: 110 kD.
Mineralocorticoid Receptor Antibody (aa950-984)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407977-100
Catalog Number: LS-C407977
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Mineralocorticoid Receptor antibody LS-C407977 is an unconjugated rabbit polyclonal antibody to Mineralocorticoid Receptor (aa950-984) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- MCR | Mineralocorticoid receptor | NR3C2 | NR3C2VIT | Aldosterone receptor | Mineralocorticoid receptor 1 | MLR | MR
- UniProt Number
- P08235
- NCBI GenBank
- NM_000901 | NP_000892.2
- SwissProt
- P08235
Target
- Target
- Human Mineralocorticoid Receptor
- Antigen Species
- Human
- Epitope
- Ubiquitous. Highly expressed in distal tubules, convoluted tubules and cortical collecting duct in kidney, and in sweat glands. Detected at lower levels in cardiomyocytes, in epidermis and in colon enterocytes. .
- Gene Name
- NR3C2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human NR3C2 (950-984 aa HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
