MGST1 antibody Western blot. All lanes: Anti MGST1 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 17 kD. Observed band size: 17 kD.

MGST1 Antibody (aa42-75)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$480.00each

Catalog Number: LS-C407935-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: MGST1 antibody LS-C407935 is an unconjugated rabbit polyclonal antibody to MGST1 (aa42-75) from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Glutathione S-transferase 12 | GST12 | MGST-I | MGST | Microsomal GST-1 | Microsomal GST-I | MGST1
UniProt Number: P10620
NCBI GenBank: NM_020300 | NP_064696.1
SwissProt: P10620

Target

Target: Human MGST1
Antigen Species: Human
Epitope: Highly expressed in liver.
Gene Name: MGST1

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human MGST1 (42-75 aa KVFANPEDCVAFGKGENAKKYLRTDDRVERVRRA), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl