Western blot analysis of MDMX expression in mouse testis extract (lane 1) and 22RV1 whole cell lysates (lane 2). MDMX at75 kD was detected using rabbit anti- MDMX Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
MDM4 / MDMX Antibody (aa35-72)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408084-100
Catalog Number: LS-C408084
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MDMX antibody LS-C408084 is an unconjugated rabbit polyclonal antibody to MDMX (MDM4) (aa35-72) from human. It is reactive with human and mouse. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Mdm2-like p53-binding protein | MDM4 | MDMX | HDMX | MRP1 | p53-binding protein Mdm4 | Protein Mdm4 | Double minute 4 protein | MDM4-related protein 1 | Protein Mdmx
- UniProt Number
- O15151
- NCBI GenBank
- NM_002393 | NP_002384.2
- SwissProt
- O15151
Target
- Target
- Human MDM4 / MDMX
- Antigen Species
- Human
- Epitope
- Expressed in all tissues tested with high levels in thymus.
- Gene Name
- MDM4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human MDMX (35-72 aa KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl