Western blot testing of 1) mouse kidney and 2) human COLO320 lysate with MC3 Receptor antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa.
MC3R / MC3 Receptor Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781974-100
Catalog Number: LS-C781974
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MC3 Receptor antibody LS-C781974 is an unconjugated rabbit polyclonal antibody to MC3 Receptor (MC3R) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BMIQ9 | MC3 receptor | MC3R | Melanocortin receptor 3 | OB20 | MC3 | MC3-R | Melanocortin 3 receptor | OQTL
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P41968
- NCBI GenBank
- NM_019888 | NP_063941.3
- SwissProt
- P41968
Target
- Target
- Human MC3R / MC3 Receptor
- Antigen Species
- Human
- Gene Name
- MC3R
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 91-121 (NALETIMIAIVHSDYLTFEDQFIQHMDNIFD) from the human protein were used as the immunogen for the MC3 Receptor antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS