Western blot - Anti-MC3 Receptor Picoband Antibody
MC3R / MC3 Receptor Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662169-100
Catalog Number: LS-C662169
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MC3 Receptor antibody LS-C662169 is an unconjugated rabbit polyclonal antibody to human MC3 Receptor (MC3R). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BMIQ9 | MC3 receptor | MC3R | Melanocortin receptor 3 | OB20 | MC3 | MC3-R | Melanocortin 3 receptor | OQTL
- UniProt Number
- P41968
- NCBI GenBank
- NM_019888 | NP_063941.3
- SwissProt
- P41968
Target
- Target
- Human MC3R / MC3 Receptor
- Antigen Species
- Human
- Epitope
- Brain, placental, and gut tissues.
- Gene Name
- MC3R
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human MC3 Receptor (91-121 aa NALETIMIAIVHSDYLTFEDQFIQHMDNIFD), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl