Western blot analysis of extracts of various cell lines, using MARCH9 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.

MARCH9 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C497303-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: MARCH9 antibody LS-C497303 is an unconjugated rabbit polyclonal antibody to MARCH9 from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: RING finger protein 179 | RNF179 | MARCH-IX | MARCH9
Recommended Dilution: WB: 1:1000 - 1:2000
UniProt Number: Q86YJ5
NCBI GenBank: NM_138396 | NP_612405.2
SwissProt: Q86YJ5

Target

Target: Human MARCH9
Antigen Species: Human
Gene Name: MARCHF9

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 277-346 of human MARCH9 (NP_612405.2). GTAGKSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)