
MAPK9 / JNK2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490593-100
Catalog Number: LS-C490593
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- JNK2 antibody LS-C490593 is an unconjugated rabbit polyclonal antibody to human JNK2 (MAPK9). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C-Jun kinase 2 | C-Jun N-terminal kinase 2 | JNK2B | JNK2 | JNK2ALPHA | MAPK9 | MAP kinase 9 | p54a | JNK2BETA | PRKM9 | SAPK | MAPK 9 | p54aSAPK | SAPK1a | JNK-55 | JNK2A | Jun kinase
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- P45984
- NCBI GenBank
- NM_002752 | NP_002743.3
- SwissProt
- P45984
Target
- Target
- Human MAPK9 / JNK2
- Antigen Species
- Human
- Gene Name
- MAPK9
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids RNYVENRPKYPGIKFEELFPDWIFPSESERDK of human JNK2a/b were used as the immunogen for the JNK2 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
