JNK2 antibody Western blot. All lanes: Anti JNK2 at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: COLO320 Whole Cell Lysate at 40 ug. Predicted band size: 48 kD. Observed band size: 48 kD.
MAPK9 / JNK2 Antibody (aa257-288)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Dog, Guinea Pig, Hamster, Horse, Human, Mammal (Other), Mouse, Pig, Rabbit, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408132-100
Catalog Number: LS-C408132
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- JNK2 antibody LS-C408132 is an unconjugated rabbit polyclonal antibody to JNK2 (MAPK9) (aa257-288) from human. It is reactive with human, mouse, rat and other species. Validated for WB.
- Application
- WB
- Reactivity
- Can, GP, Ham, Hr, Hu, Mml, Ms, Por, Rb, Rt, Sh
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C-Jun kinase 2 | C-Jun N-terminal kinase 2 | JNK2B | JNK2 | JNK2ALPHA | MAPK9 | MAP kinase 9 | p54a | JNK2BETA | PRKM9 | SAPK | MAPK 9 | p54aSAPK | SAPK1a | JNK-55 | JNK2A | Jun kinase
- UniProt Number
- P45984
- NCBI GenBank
- NM_002752, NP_002743.3
- SwissProt
- P45984
Target
- Target
- Human MAPK9 / JNK2
- Antigen Species
- Hu
- Gene Name
- MAPK9
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human JNK2 (257-288 aa RNYVENRPKYPGIKFEELFPDWIFPSESERDK), identical to the related mouse and rat sequences.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl