Western blot analysis of extracts of various cell lines, using MAPK8 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
MAPK8 / JNK1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C746814-20
Catalog Number: LS-C746814
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- JNK1 antibody LS-C746814 is an unconjugated rabbit polyclonal antibody to JNK1 (MAPK8) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- JNK | JNK1 | JNK1A2 | JNK-46 | MAP kinase 8 | PRKM8 | SAPK1 | SAPK1c | MAPK 8 | C-Jun N-terminal kinase 1 | JNK21B1/2 | JUN N-terminal kinase | MAPK8
- Recommended Dilution: WB
- 1:500 - 1:1000
- UniProt Number
- P45983
- NCBI GenBank
- NM_139049 | NP_620637.1
- SwissProt
- P45983
Target
- Target
- Human MAPK8 / JNK1
- Antigen Species
- Human
- Gene Name
- MAPK8
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 245-345 of human MAPK8 (NP_620635.1). CPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDER
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS