MAPK3 / ERK1 Antibody (aa336-367)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunoprecipitation, Western Blot |
| Reactivity: | Hamster, Mouse, Rabbit, Rat |
| Format: | Liquid |
$604.00each
Catalog Number: LS-C16357-50
Catalog Number: LS-C16357
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ERK1 antibody LS-C16357 is an unconjugated rabbit polyclonal antibody to ERK1 (MAPK3) (aa336-367) from rat. It is reactive with mouse, rat, hamster and other species. Validated for IHC, IP and WB.
- Application
- IHC, IP, WB
- Reactivity
- Ham, Ms, Rb, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ERK-1 | ERT2 | HUMKER1A | HS44KDAP | MAP kinase 1 | MAP kinase isoform p44 | MAPK 1 | MAPK 3 | p44 | p44MAPK | p44-MAPK | p44ERK1 | MAP kinase 3 | p44-ERK1 | ERK1 | MAPK3 | PRKM3
- UniProt Number
- P27361
- NCBI GenBank
- CAA42744.1|X60188
- SwissProt
- P27361
Target
- Target
- Rat MAPK3 / ERK1
- Antigen Species
- Rat
- Epitope
- This immunoaffinity purified antibody detects ~42kD and ~44kD bands corresponding to Erk1 and Erk2, respectively. The antibody recognizes Erk1 and Erk2 in samples from human, mouse, rat, bovine, chicken, Drosophila, sheep, Xenopus and mussel. Antibody specificity is confirmed by peptide competition studies.
- Gene Name
- MAPK3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- A 35 residue synthetic peptide, corresponding to aa 333-367 {(CGG)PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP}, of rat Erk1 MAP kinase with the CGG spacer group added and the peptide coupled to KLH. Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%); Monkey, Bovine, Dog, Bat, Horse, Platypus (97%); Human, Gorilla, Gibbon, Elephant (94%); Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%); Xenopus (84%).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- Liquid
- Preservative
- No
- Purification Method
- Protein A Affinity
Storage & Handling
- Storage Conditions
- Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.