
MAPK14 / p38 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunoprecipitation, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C749403-20
Catalog Number: LS-C749403
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- P38 antibody LS-C749403 is an unconjugated rabbit polyclonal antibody to p38 (MAPK14) from human. It is reactive with human, mouse and rat. Validated for IHC, IP and WB.
- Application
- IHC, IP, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CSAID-binding protein | CSBP2 | CSPB1 | CSBP1 | Csaids binding protein | CSBP | EXIP | MAP kinase 14 | MAP kinase p38 alpha | MAX-interacting protein 2 | MAPK 14 | MAPK14 | p38 alpha | PRKM15 | PRKM14 | RK | SAPK2A | MAP kinase MXI2 | Mxi2 | p38ALPHA | p38 | p38 MAP kinase | p38alpha Exip
- UniProt Number
- Q16539
- NCBI GenBank
- NM_001315 | NP_001306.1
- SwissProt
- Q16539
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC | 1:50 - 1:200 |
| IP | 1:50 - 1:100 |
| WB | 1:500 - 1:1000 |
Target
- Target
- Human MAPK14 / p38
- Antigen Species
- Human
- Gene Name
- MAPK14
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 300 to the C-Terminus of human MAPK14 (NP_620581.1). AQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS with 0.09% Sodium azide,50% glycerol,pH7.3
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
