MAOB antibody Western blot. All lanes: Anti MAOB at 0.5 ug/ml. Lane 1: Rat Cardiac Muscle Tissue Lysate at 50 ug. Lane 2: Rat Kidney Tissue Lysate at 50 ug. Lane 3: Rat Intestine Tissue Lysate at 50 ug. Lane 4: Mouse Kidney Tissue Lysate at 50 ug. Lane 5: Mouse Intestine Tissue Lysate at 50 ug. Lane 6: Mouse Cardiac Muscle Tissue Lysate at 50 ug. Lane 7: HEPG2 Whole Cell Lysate at 40 ug. Lane 8: HELA Whole Cell Lysate at 40 ug. Lane 9: COLO320 Whole Cell Lysate at 40 ug. Predicted band size: 59 kD. Observed band size: 59 kD.
MAOB / Monoamine Oxidase B Antibody (aa448-484)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Dog, Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407878-100
Catalog Number: LS-C407878
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Monoamine Oxidase B antibody LS-C407878 is an unconjugated rabbit polyclonal antibody to Monoamine Oxidase B (MAOB) (aa448-484) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Can, Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Adrenalin oxidase | MAO, brain | MAO-B | Monoamine oxidase type B | MAO, platelet | Tyramine oxidase | MAOB | Monoamine oxidase B
- UniProt Number
- P27338
- NCBI GenBank
- NM_000898 | NP_000889.3
- SwissProt
- P27338
Target
- Target
- Human MAOB / Monoamine Oxidase B
- Antigen Species
- Human
- Gene Name
- MAOB
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human MAOB (448-484 aa REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl