Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot testing of human 1) HepG2 and 2) MCF7 cell lysate with MAK antibody at 0.5ug/ml. Predicted molecular weight ~70 kDa.
MAK Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782028-100
Catalog Number: LS-C782028
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MAK antibody LS-C782028 is an unconjugated rabbit polyclonal antibody to human MAK. Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- DJ417M14.2 | MAK | HMAK | RP62
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P20794
- NCBI GenBank
- NM_005906 | NP_005897.1
- SwissProt
- P20794
Target
- Target
- Human MAK
- Antigen Species
- Human
- Gene Name
- MAK
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 588-623 (RTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR) were used as the immunogen for the MAK antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
