Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
LYZL6 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin |
| Reactivity: | Human |
| Format: | Liquid |
$1048.00each
Catalog Number: LS-C122076-100
Catalog Number: LS-C122076
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- LYZL6 antibody LS-C122076 is an unconjugated rabbit polyclonal antibody to human LYZL6. Validated for IHC.
- Application
- IHC, IHC-P
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- LYZL6 | LYC1 | Lysozyme homolog | PRO1485 | Lysozyme-like 6 | Lysozyme-like protein 6 | TKAL754 | UNQ754
- UniProt Number
- O75951
- NCBI GenBank
- NM_020426|NP_065159.1
- SwissProt
- O75951
Target
- Target
- Human LYZL6
- Antigen Species
- Human
- Epitope
- Recognizes human Lysozyme-like 6.
- Gene Name
- LYZL6
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Lysozyme-like protein 6 Precursor recombinant protein epitope signature tag (PrEST), immunogen sequence CNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRP. Percent identity by BLAST analysis: Human, Gorilla (100%); Gibbon (97%); Monkey, Marmoset (90%).
- Immunogen Type
- Recombinant Immunogen
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.2, 0.02% Sodium Azide, 40% Glycerol
- Volume
- 100 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- May be stored at 4°C for short-term only. For long-term storage, store at -20°C. Aliquots are stable for up to 1 year at -20°C.
- Recommended Storage Buffer
- PBS
