IHC staining of FFPE mouse spleen with CD229 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
LY9 / CD229 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry, Immunohistochemistry, Paraffin |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782265-100
Catalog Number: LS-C782265
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CD229 antibody LS-C782265 is an unconjugated rabbit polyclonal antibody to CD229 (LY9) from human. It is reactive with human, mouse and rat. Validated for Flow and IHC.
- Application
- FC, IHC-P
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CD229 | CD229 antigen | Cell surface molecule Ly-9 | Hly9 | Lymphocyte antigen 9 | MLY9 | SLAMF3 | LY9
- Recommended Dilution: FC
- 1 - 3 µg/10E6 cells
- Recommended Dilution: IHC-P
- 1 - 2 µg/ml
- UniProt Number
- Q9HBG7
- SwissProt
- Q9HBG7
Target
- Target
- Human LY9 / CD229
- Antigen Species
- Human
- Gene Name
- LY9
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids YKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMK were used as the immunogen for the CD229 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- 1X PBS