Western blot analysis of extracts of various cell lines, using LTB4R2 antibody. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.
LTB4R2 / BLT2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C750450-20
Catalog Number: LS-C750450
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- BLT2 antibody LS-C750450 is an unconjugated rabbit polyclonal antibody to BLT2 (LTB4R2) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BLT2 | BLTR2 | Blt-2 | BLT2R | JULF2 | LTB4-R2 | LTB4R2 | Hblt2 | KPG_004 | Leukotriene B4 receptor 2 | Leukotriene B4 receptor BLT2 | LTB4 receptor JULF2 | LTB4-R 2
- Recommended Dilution: WB
- 1:200 - 1:2000
- UniProt Number
- Q9NPC1
- NCBI GenBank
- NM_019839 | NP_062813.2
- SwissProt
- Q9NPC1
Target
- Target
- Human LTB4R2 / BLT2
- Antigen Species
- Human
- Gene Name
- LTB4R2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 254-358 of human LTB4R2 (NP_062813.2). PPEGALAKLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Concentration
- 4.17 mg/mL
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS