
Western blot analysis of extracts of NCL-H460 cells.
LSM2 / SnRNP Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409532-20
Catalog Number: LS-C409532
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SnRNP antibody LS-C409532 is an unconjugated rabbit polyclonal antibody to human SnRNP (LSM2). Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- G7B | LSM2 | Protein G7b | YBL026W | SnRNP | C6orf28
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q9Y333
- NCBI GenBank
- NM_021177 | NP_067000.1
- SwissProt
- Q9Y333
Target
- Target
- Human LSM2 / SnRNP
- Antigen Species
- Human
- Epitope
- Human LSM2 / SnRNP
- Gene Name
- LSM2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human LSM2 (NP_067000.1). MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
