Western blot testing of human Caco-2 lysate with LRIG1 antibody at 0.5ug/ml. Expected molecular weight: 119-145 kDa depending on glycosylation level. Soluble fragments of 90-105 kDa and 60-70 kDa may also be observed.

LRIG1 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782863-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: LRIG1 antibody LS-C782863 is an unconjugated rabbit polyclonal antibody to human LRIG1. Validated for IHC and WB.
Application: IHC-P, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: DKFZP586O1624 | LIG-1 | LRIG1
Recommended Dilution: IHC-P: 1 - 2 µg/ml
Recommended Dilution: WB: 0.5 - 1 µg/ml

Target

Target: Human LRIG1
Antigen Species: Human

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG

Immunogen

Immunogen: Amino acids AKRAFSGLESLEHLNLGENAIRSVQFDAFAKMKNLKELYI were used as the immunogen for the LRIG1 antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: 1X PBS