Western blot - Anti-P2RY5 Picoband antibody
LPAR6 / P2RY5 / P2Y5 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662793-100
Catalog Number: LS-C662793
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- P2Y5 antibody LS-C662793 is an unconjugated rabbit polyclonal antibody to human P2Y5 (LPAR6 / P2RY5). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ARWH1 | LAH3 | LPA receptor 6 | LPA-6 | p2RY5 | p2Y5 | Purinergic receptor 5 | Purinergic receptor p2y5 | LPAR6 | p2Y purinoceptor 5
- UniProt Number
- P43657
- NCBI GenBank
- NM_005767 | NP_005758.2
- SwissProt
- P43657
Target
- Target
- Human LPAR6 / P2RY5 / P2Y5
- Antigen Species
- Human
- Epitope
- Expressed ubiquitously, including in skin and hair follicle cells. Detected in both Henle's and Huxley's layers of the inner root sheath of the hair follicle and in suprabasal layers of the epidermis (at protein level). Expressed at low levels in peripheral blood leukocytes.
- Gene Name
- LPAR6
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human P2RY5 (DTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLK).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl