Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
LOXL2 antibody Western blot. All lanes: Anti LOXL2 at 0.5 ug/ml. Lane 1: Mouse Testis Tissue Lysate at 50 ug. Lane 2: Rat Ovary Tissue Lysate at 50 ug. Lane 3: Human Placenta Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Lane 5: 22RV1 Whole Cell Lysate at 40 ug. Lane 6: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 87 kD. Observed band size: 87 kD.
LOXL2 Antibody (aa739-770)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407932-100
Catalog Number: LS-C407932
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- LOXL2 antibody LS-C407932 is an unconjugated rabbit polyclonal antibody to LOXL2 (aa739-770) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- LOXL2 | Lysyl oxidase-like protein 2 | Lysyl oxidase related 2 | Lysyl oxidase-like 2 | WS9-14 | LOR2 | Lysyl oxidase homolog 2
- UniProt Number
- Q9Y4K0
- NCBI GenBank
- NM_002318 | NP_002309.1
- SwissProt
- Q9Y4K0
Target
- Target
- Human LOXL2
- Antigen Species
- Human
- Epitope
- Expressed in many tissues. Highest expression in reproductive tissues, placenta, uterus and prostate. Up- regulated in a number of cancers cells and tissues.
- Gene Name
- LOXL2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human LOXL2 (739-770 aa HRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ), different from the related mouse and rat sequences by four amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
