Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot analysis of LMO2 using anti-LMO2 antibody
LMO2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662955-100
Catalog Number: LS-C662955
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- LMO2 antibody LS-C662955 is an unconjugated rabbit polyclonal antibody to human LMO2. Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- LIM domain only protein 2 | LMO-2 | RHOM2 | RBTNL1 | Rhombotin 2 | Rhombotin-like 1 | Cysteine-rich protein TTG-2 | LMO2 | RBTN2 | Rhombotin-2 | T-cell translocation gene 2 | T-cell translocation protein 2 | TTG2
- UniProt Number
- P25791
- NCBI GenBank
- NM_005574 | NP_005565.2
- SwissProt
- P25791
Target
- Target
- Human LMO2
- Antigen Species
- Human
- Gene Name
- LMO2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human LMO2 (QKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
