Western blot - Anti-LMO1 Picoband Antibody

LMO1 Antibody

Name: LMO1 Antibody
Brand: LSBio
SKU: LS-C662242-100
Price: 480 USD
Availability: InStock

$480.00each

Catalog Number: LS-C662242-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: LMO1 antibody LS-C662242 is an unconjugated rabbit polyclonal antibody to human LMO1. Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Cysteine-rich protein TTG-1 | LIM domain only protein 1 | LMO-1 | RBTN1 | RHOM1 | Rhombotin-1 | T-cell translocation protein 1 | T-cell translocation gene 1 | TTG1 | LMO1
UniProt Number: P25800
NCBI GenBank: NM_002315 | NP_002306.1
SwissProt: P25800

Target: Human LMO1
Antigen Species: Human
Epitope: Expressed mainly in the central nervous. Low level of expression in other tissues including thymus. .
Gene Name: LMO1

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human LMO1 (127-156 aa DKFFLKNNMILCQMDYEEGQLNGTFESQVQ), different from the related mouse sequence by two amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Preservative: Yes
Purification Method: Affinity Purified

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl