Western blot analysis of extracts of various cell lines, using LLGL2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.

LLGL2 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C748377-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: LLGL2 antibody LS-C748377 is an unconjugated rabbit polyclonal antibody to LLGL2 from mouse. It is reactive with mouse and rat. Validated for WB.
Application: WB
Reactivity: Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: LLGL2 | Human giant larvae homolog | HGL | LGL2
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q6P1M3
NCBI GenBank: NM_004524 | NP_004515.2
SwissProt: Q6P1M3

Target

Target: Mouse LLGL2
Antigen Species: Mouse
Gene Name: LLGL2

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence within amino acids 900-1000 of mouse LLGL2 (NP_663413.2). IASCVFTKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSTKAKKHNRPSNGNGTGLKMTSSGHVRNSKSQSDGDEKKPGPVMEHALLNDAWVLKEIQSTL
Immunogen Type: Synthetic Peptide (Linear)