Western blot analysis of extracts of various cell lines.
LIN28A / LIN28 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C334475-20
Catalog Number: LS-C334475
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- LIN28 antibody LS-C334475 is an unconjugated rabbit polyclonal antibody to LIN28 (LIN28A) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CSDD1 | Lin-28 homolog (C. elegans) | LIN-28 | Lin-28A | LIN28 | LIN28A | Protein lin-28 homolog A | Lin-28 homolog A (C. elegans) | ZCCHC1 | RNA-binding protein LIN-28
- Recommended Dilution: WB
- 1:500 - 1:1000
- UniProt Number
- Q9H9Z2
- NCBI GenBank
- NM_024674 | NP_078950.1
- SwissProt
- Q9H9Z2
Target
- Target
- Human LIN28A / LIN28
- Antigen Species
- Human
- Epitope
- Human LIN28A / LIN28
- Gene Name
- LIN28A
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 142-209 of human LIN28 (NP_078950.1). CGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS