Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
LIM kinase 2 antibody Western blot. All lanes: Anti LIM kinase 2 at 0.5 ug/ml. Lane 1: Mouse Brain Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: Mouse Thymus Tissue Lysate at 50 ug. Lane 4: Mouse Testis Tissue Lysate at 50 ug. Lane 5: 293T Whole Cell Lysate at 40 ug. Lane 6: HELA Whole Cell Lysate at 40 ug. Predicted band size: 72 kD. Observed band size: 72 kD.
LIMK2 Antibody (aa596-635)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Horse, Human, Mouse |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407929-100
Catalog Number: LS-C407929
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- LIMK2 antibody LS-C407929 is an unconjugated rabbit polyclonal antibody to LIMK2 (aa596-635) from human. It is reactive with human, mouse and horse. Validated for WB.
- Application
- WB
- Reactivity
- Hr, Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- LIM domain kinase 2 | LIMK2 | LIM kinase 2 | LIMK-2
- UniProt Number
- P53671
- NCBI GenBank
- NM_016733 | NP_057952.1
- SwissProt
- P53671
Target
- Target
- Human LIMK2
- Antigen Species
- Human
- Epitope
- Highest expression in the placenta; moderate level in liver, lung, kidney, and pancreas. LIMK2a is found to be more abundant then LIMK2b in liver, colon, stomach, and spleen, while in brain, kidney, and placenta LIMK2b is the dominant form. In adult lung, both LIMK2a and LIMK2b is nearly equally observed. .
- Gene Name
- LIMK2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human LIM kinase 2 (596-635 aa KLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRD), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino a
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
