Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot analysis of 721_B cell lysate using LCN6 antibody.
LCN6 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C331345-20
Catalog Number: LS-C331345
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- LCN6 antibody LS-C331345 is an unconjugated rabbit polyclonal antibody to mouse LCN6. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- LCN6 | LCN5 | Lipocalin-5 | Lipocalin 6 | UNQ643 | HLcn5 | Lipocalin 5
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P62502
- SwissProt
- P62502
Target
- Target
- Human LCN6
- Antigen Species
- Human
- Epitope
- Human LCN6
- Gene Name
- LCN6
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 25-120 of human LCN6 (NP_945184.1). RLDPEQLLGPWYVLAVASREKGFAMEKDMKNVVGVVVTLTPENNLRTLSSQHGLGGCDQSVMDLIKRNSGWVFENPSIGVLELWVLATNFRDYAII
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
