Human Apolipoprotein H Antibody (IgA) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67373-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
LCAT antibody Western blot. All lanes: Anti LCAT at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Testis Tissue Lysate at 50 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Predicted band size: 50 kD. Observed band size: 50 kD.
LCAT Antibody (aa389-423)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407869-100
Catalog Number: LS-C407869
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- LCAT antibody LS-C407869 is an unconjugated rabbit polyclonal antibody to LCAT (aa389-423) from mouse. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- LCAT
- UniProt Number
- P04180
- NCBI GenBank
- NM_000229, NP_000220.1
- SwissProt
- P04180
Target
- Target
- Mouse LCAT
- Antigen Species
- Ms
- Epitope
- Detected in blood plasma (PubMed:8820107). Produced and secreted by astrocytes (at protein level) (PubMed:19065001). Abundantly expressed in liver, brain and testis with highest levels in liver. In the brain, found in cerebellum, cerebral cortex, hippocampus and brain stem. Located to neurons and neuroglia. .
- Gene Name
- LCAT
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of mouse LCAT (389-423 aa QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR), different from the related human sequence by six amino acids, and from the related rat sequence by four amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
