IHC testing of FFPE mouse brain tissue with L1CAM antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.

L1CAM Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry, Paraffin
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782087-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: L1CAM antibody LS-C782087 is an unconjugated rabbit polyclonal antibody to L1CAM from human. It is reactive with human, mouse and rat. Validated for IHC.
Application: IHC-P
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: CAML1 | CD171 antigen | HSAS | HSAS1 | L1CAM | MASA | MIC5 | N-CAM-L1 | N-CAML1 | L1 cell adhesion molecule | NCAM-L1 | S10 | SPG1 | CD171
Recommended Dilution: IHC-P: 1 - 2 µg/ml
UniProt Number: P32004
NCBI GenBank: NP_000416.1
SwissProt: P32004

Target

Target: Human L1CAM
Antigen Species: Human
Gene Name: L1CAM

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW were used as the immunogen for the L1CAM antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS